View Full Version : Drugs
Ahldagor
04-14-2014, 02:46 PM
not in my area, or at least not many people do it or keep it real quiet. Have only heard of one heroin bust. Im sure down south in the populated cities its there but out in here in the sticks its weed, shrooms, and scripts.
scripts are bad m'kay. really wonder why so many rednecks/hicks/stick dwellers/what ever epithet you can think of are pill addicts tho
Rhambuk
04-14-2014, 02:51 PM
so easy to get and overprescribed
Ahldagor
04-14-2014, 03:05 PM
so easy to get and overprescribed
/nod
Rhambuk
04-14-2014, 05:06 PM
haha i remember when i was lke 22 working and going to college i told my doctor i was tired and having a hard time focusing, no shit. He said how about ritalin? tried that and was like, eh its okay. alright heres some aderall lemme know how that goes...okay.
they just throw pills at people so fast
Peatree
04-14-2014, 05:10 PM
I miss the days when MDMA was legal. You could buy good clean X and any "Gas Pipe" head shop in north DFW area. Not to mention when you walked into the Stark Club they offered you a free hit of X or a free shot just to get things rolling.
DeruIsLove
04-14-2014, 05:10 PM
haha i remember when i was lke 22 working and going to college i told my doctor i was tired and having a hard time focusing, no shit. He said how about ritalin? tried that and was like, eh its okay. alright heres some aderall lemme know how that goes...okay.
they just throw pills at people so fast
That's how they make their money.
Champion_Standing
04-14-2014, 05:11 PM
Im kind of thankful I live in maine, none of that stuff is up here. No crack, barely any coke and its super cut, no angel dust, no heroin (not reeaalllly anyway)
If that stuff was around me a few years ago id be in a gutter, or most likely dead by now.
PCP died off in the 80's and blow has to be transported great distances, but meth...you can cook that shit anywhere.
http://www.pressherald.com/news/Evidence_of_meth_labs_leads_Maine_police_to_detain _five_people.html
I'm sure you could find plenty of other articles like that, was just the most recent one on the google.
Rhambuk
04-14-2014, 05:13 PM
PCP died off in the 80's and blow has to be transported great distances, but meth...you can cook that shit anywhere.
yeah there was this special on netflix drug wars or something, the episode focused on meth and no shit recorded this bitch shopping for materials, shes talking about what its for and how much. Then goes home and makes meth with it, they record the whole process with her instructions and air it.
I almost went down to the 7/11 to cook up some meth that night!
pharmakos
04-14-2014, 07:06 PM
this stuff is okay: http://en.wikipedia.org/wiki/3-MeO-PCP
Rhambuk
04-14-2014, 07:13 PM
sounds like too much fun
mtb tripper
04-14-2014, 09:45 PM
chemicals in our bodies
pharmakos
04-14-2014, 09:57 PM
"People took such awful chances with chemicals and their bodies because they wanted the quality of their lives to improve. They lived in ugly places where there were only ugly things to do. They didn't own doodley-squat, so they couldn't improve their surroundings. So they did their best to make their insides beautiful instead."
- Breakfast of Champions by Kurt Vonnegut
mtb tripper
04-14-2014, 10:20 PM
"People took such awful chances with chemicals and their bodies because they wanted the quality of their lives to improve. They lived in ugly places where there were only ugly things to do. They didn't own doodley-squat, so they couldn't improve their surroundings. So they did their best to make their insides beautiful instead."
- Breakfast of Champions by Kurt Vonnegut
I am very close to moving to Tacoma with nothing but my acoustic and about 800 dollars. I'm feeling a very long h binge. I feel as if it has come to that point of illusion and disembodiment with my peers and surroundings. I would like the people of this forums opinion on this, maybe not binging as far as threatening my life but definitely to the point where I can't comprehend what is going on around me or right from wrong, ultimate apathy. Is living on the streets of Tacoma going to be difficult?
After the 800 dollars is quickly used up, I will earn money playing on the streets with my guitar case open, earning just enough for a "snack" before the end of the day so that I won't shake. Wake up and repeat.
After my hair is dreadlocked and matted and I realize I am a worthless piece of shit and I must make something out of myself and at least pay taxes to make a small contribution to society; I will probably hitchhike back to my hometown and live off of old childhood friends and cut my hair and get a job working at a fast food establishment. Is this realistic? Could this work?
Thank you people for your time and inner honesty. With our love we can save the world
DeruIsLove
04-14-2014, 10:24 PM
When you die the world that you obviously can't handle will be that much better.
The world is getting better every day, one dead hippy at a time.
Rhambuk
04-14-2014, 11:32 PM
Thank you people for your time and inner honesty. With our love we can save the world
best of luck brother!
Faerie
04-14-2014, 11:35 PM
Sobriety is a chemically-induced state of mind.
http://img.pandawhale.com/45822-Keanu-Bill-and-Ted-whoa-gif-Yr7D.gif
But seriously, you guys should calm down with the drugs.
Ahldagor
04-15-2014, 12:09 AM
drugs are fun and better publicly than in private.
mtb tripper
04-15-2014, 01:05 AM
drugs are fun and better publicly than in private.
I really prefer drugs in private because you don't have to worry about your surroundings, you can really focus on inner qualities and realization, at least with psychedelics. Stimulants on the other hand fucking rock in public
I really prefer drugs in private because you don't have to worry about your surroundings, you can really focus on inner qualities and realization, at least with psychedelics. Stimulants on the other hand fucking rock in public
a small does of shrooms in public makes for some great times. everything is amazing and you got that great body high going, did that a few times in high school.. classes were meh.. soon as you stepped outside though.. ZAAAAAAAAAAAAAAAAAAANG
mtb tripper
04-15-2014, 01:28 AM
a small does of shrooms in public makes for some great times. everything is amazing and you got that great body high going, did that a few times in high school.. classes were meh.. soon as you stepped outside though.. ZAAAAAAAAAAAAAAAAAAANG
I love the natural brightness the outdoors always brings with shrooms
Ahldagor
04-15-2014, 01:55 AM
a small does of shrooms in public makes for some great times. everything is amazing and you got that great body high going, did that a few times in high school.. classes were meh.. soon as you stepped outside though.. ZAAAAAAAAAAAAAAAAAAANG
drove to new orleans on shrooms. atchafalaya bridge was a wonderful bwawp bwawp and swamp foliage
Altair
04-15-2014, 01:59 AM
Wonder how many radio stations will be playing "Darkside of the Moon" tonite?
mtb tripper
04-15-2014, 02:06 AM
Wonder how many radio stations will be playing "Darkside of the Moon" tonite?
Hopefully enough to play in earshot of the right people at just the right time.
mtb tripper
04-15-2014, 02:08 AM
http://31.media.tumblr.com/02effc781a523e899a7bdf8f5bcabd67/tumblr_mroa9vYDWA1srywodo1_400.gif
http://37.media.tumblr.com/63d47cb8e1350a009aeb243c56b2658c/tumblr_muikbfNxi21sdcl88o1_400.gif
http://37.media.tumblr.com/tumblr_lu5vy8TMvq1qmwd3eo1_500.gif
Altair
04-15-2014, 02:27 AM
lasts a couple hours, so right time is relative.
pharmakos
04-15-2014, 11:49 AM
I am very close to moving to Tacoma with nothing but my acoustic and about 800 dollars. I'm feeling a very long h binge. I feel as if it has come to that point of illusion and disembodiment with my peers and surroundings. I would like the people of this forums opinion on this, maybe not binging as far as threatening my life but definitely to the point where I can't comprehend what is going on around me or right from wrong, ultimate apathy. Is living on the streets of Tacoma going to be difficult?
After the 800 dollars is quickly used up, I will earn money playing on the streets with my guitar case open, earning just enough for a "snack" before the end of the day so that I won't shake. Wake up and repeat.
After my hair is dreadlocked and matted and I realize I am a worthless piece of shit and I must make something out of myself and at least pay taxes to make a small contribution to society; I will probably hitchhike back to my hometown and live off of old childhood friends and cut my hair and get a job working at a fast food establishment. Is this realistic? Could this work?
Thank you people for your time and inner honesty. With our love we can save the world
reach for the stars
pharmakos
04-15-2014, 11:52 AM
you know whats trippy? for the most part the spectrum makes sense in order. combine red and yellow and you get orange, the color right between red and yellow. combine yellow and blue and you get green, the color right between yellow and blue.
but to get purple you combine red and blue, and purple is way the fuck at the opposite end of the spectrum from red.
the fuck?
would almost make sense if it were cyclical, but its not -- higher frequencies than purple do not look red. (at least not to humans)
i suppose color itself is a qualia, though, and not actually a property of matter itself.
mtb tripper
04-15-2014, 02:19 PM
you know whats trippy? for the most part the spectrum makes sense in order. combine red and yellow and you get orange, the color right between red and yellow. combine yellow and blue and you get green, the color right between yellow and blue.
but to get purple you combine red and blue, and purple is way the fuck at the opposite end of the spectrum from red.
the fuck?
would almost make sense if it were cyclical, but its not -- higher frequencies than purple do not look red. (at least not to humans)
i suppose color itself is a qualia, though, and not actually a property of matter itself.
It is very trippy, the thought of light reflection producing certain colors, and colors creating emotions. No light no color no emotion
Ahldagor
04-15-2014, 02:27 PM
It is very trippy, the thought of light reflection producing certain colors, and colors creating emotions. No light no color no emotion
one thing i've pondered on is love and possession. odd link with them.
Orruar
04-15-2014, 04:13 PM
It is very trippy, the thought of light reflection producing certain colors, and colors creating emotions. No light no color no emotion
Blind people don't have emotions by your theory?
Orruar
04-15-2014, 04:18 PM
you know whats trippy? for the most part the spectrum makes sense in order. combine red and yellow and you get orange, the color right between red and yellow. combine yellow and blue and you get green, the color right between yellow and blue.
but to get purple you combine red and blue, and purple is way the fuck at the opposite end of the spectrum from red.
the fuck?
would almost make sense if it were cyclical, but its not -- higher frequencies than purple do not look red. (at least not to humans)
i suppose color itself is a qualia, though, and not actually a property of matter itself.
Color is a property of light. Qualia are the way we perceive the color. No matter what qualia you or I ascribe to particular colors of light, combining paint with the color at ~700nm (red) with paint with the color at ~580nm (yellow) will produce paint with color at ~600nm (orange). That is an actual physical property and perception doesn't change that fact. Everyone who isn't colorblind sees the same red + yellow = orange, irrespective of the qualia they perceive when looking at these colors.
Also note that combining colors of light is different than combining paint of a certain color. If you combine red and yellow light, you get white light.
pharmakos
04-15-2014, 04:30 PM
^ color is not a property of light, it is a property of our eyes/brains
and not everyone sees color the same way -- see: Tetrachromacy (http://en.wikipedia.org/wiki/Tetrachromacy)
pharmakos
04-15-2014, 04:30 PM
also, there are colors that humans can see that don't exist on the normal spectrum -- i.e. Pink.
Orruar
04-15-2014, 04:44 PM
^ color is not a property of light, it is a property of our eyes/brains
and not everyone sees color the same way -- see: Tetrachromacy (http://en.wikipedia.org/wiki/Tetrachromacy)
Ok, granted, not everyone sees color the same way and yes, color is created in the brain. But the wavelengths of light that produce a certain color is a physical property of the light. That's why everyone who isn't color blind can say "red and blue make purple". If our perception of mixed colors are purely a function of our mind and had no physical basis, the color wheel wouldn't make sense to everyone the same way. One person would see red and blue mixed together to make green while another would see it make purple. So the mixing of colors does have objective physical properties, which are then translated into color (qualia) later. So your nihilism regarding understanding how colors mix is misplaced.
pharmakos
04-15-2014, 05:00 PM
http://www.biotele.com/magenta_files/2007_02_09_ProfProbing_MagentaSpectrum.jpg
pharmakos
04-15-2014, 05:03 PM
and also, i think you misunderstood my original point
combining paint with the color at ~700nm (red) with paint with the color at ~580nm (yellow) will produce paint with color at ~600nm (orange)
that's all fine and dandy, and i understand how mixing two colors will give you a color roughly in between those two on the spectrum
but why then when you mix red (long wavelength) with blue (short wavelength) do you get purple (even shorter wavelength)?
pharmakos
04-15-2014, 05:07 PM
also, back on topic:
http://i40.tinypic.com/6qe1r9.png
Orruar
04-15-2014, 05:25 PM
and also, i think you misunderstood my original point
that's all fine and dandy, and i understand how mixing two colors will give you a color roughly in between those two on the spectrum
but why then when you mix red (long wavelength) with blue (short wavelength) do you get purple (even shorter wavelength)?
I wasn't addressing that part of your post. I was addressing your final conclusion:
"i suppose color itself is a qualia, though, and not actually a property of matter itself."
This to me sounded as if you thought there wasn't an answer to this question since color was just a qualia and therefore could not be scientifically described. I don't agree with that. I believe there is an answer and you can probably find it somewhere on this grand thing we call the internet.
pharmakos
04-15-2014, 05:31 PM
hm, color is one of the prime examples of what a qualia is, though.
mtb tripper
04-15-2014, 07:14 PM
one thing i've pondered on is love and possession. odd link with them.
Love and possession do not go together in my opinion
mtb tripper
04-15-2014, 07:15 PM
Imagine a blind person taking lsd
pharmakos
04-15-2014, 08:04 PM
i usually don't get open-eyed visuals from psychedelics. if i do they tend to be very light.
i think its from my years of dissociative abuse -- i once read a research paper about how dissociative tolerance can cause changes in the qualitative effects of 5HT-2A agonists. something about downstream gluataminergic effects and changes in receptor expression, idk.
i definitely still can trip pretty hard, though, but the effects are mostly mental and auditory.
Ahldagor
04-15-2014, 08:45 PM
Love and possession do not go together in my opinion
my boyfriend
my girlfriend
my wife
my husband
my cat
my dog
my brother
my sister
my hooker
my lover
my vibrator
my hand
it's in language which is where my thought generated from. a lot of what we consider love has an object attached to it that is usually expressed in the possessive when it isn't spoken in a general such as "i love a blue sky". it's something i've thought about sober and not for a few years now.
mtb tripper
04-15-2014, 10:44 PM
http://31.media.tumblr.com/5190ab28f32d435a0dc895515402d828/tumblr_msrtt03dT41s92vobo1_500.gif
http://24.media.tumblr.com/a311d6d716760f65651fc2c86a2b24a9/tumblr_mndb1mHkPD1qdqks3o1_500.jpg
http://37.media.tumblr.com/aa82203bc5f6eec5997634518a1f73ad/tumblr_mqnyu3vgSY1sagudio1_500.jpg
http://24.media.tumblr.com/69aba289164c22224feff89d402a555d/tumblr_mvpj5lLQSN1sfldlzo1_500.gif
http://37.media.tumblr.com/b992bfdd732c30626e87773a08af2877/tumblr_mxemivg39t1s8ml3ro1_500.gif
http://31.media.tumblr.com/4b417cf9ddf0161ab726e2e2ed28f97c/tumblr_mfnm4yPsDr1s1txd3o1_500.gif
http://24.media.tumblr.com/tumblr_lkc5uoaisu1qae83po1_400.jpg
http://37.media.tumblr.com/tumblr_m6tmg5vc0W1rr86mho1_500.gif
http://37.media.tumblr.com/ea33d9aec49d7d90646dcdc62429d357/tumblr_mj5aiplnNr1rfxap8o1_500.gif
This last one is a repeat but I just love it so much so I will post it again
http://24.media.tumblr.com/tumblr_mddauwNDZR1rz1uqto1_500.gif
pharmakos
04-16-2014, 05:14 AM
why is the modern slang "i took a drug"?
does "took" as a synonym for "consumed" go back to theft?
Knuckle
04-16-2014, 07:31 PM
my boyfriend
my girlfriend
my wife
my husband
my cat
my dog
my brother
my sister
my hooker
my lover
my vibrator
my hand
it's in language which is where my thought generated from. a lot of what we consider love has an object attached to it that is usually expressed in the possessive when it isn't spoken in a general such as "i love a blue sky". it's something i've thought about sober and not for a few years now.
yes because how does one explain the subject they are referring to if you don't add a possessive? Hi I'd like you to meet wife. Hi, this is a significant other with which I have attached feelings. Hi, this is a wife.
Hi, this is my wife.
You are overanalyzing the wrong stuff.
pharmakos
04-16-2014, 08:31 PM
http://i.imgur.com/ube5s7p.jpg
http://30.media.tumblr.com/tumblr_lih6whEzlO1qhj9apo1_500.jpg
seen these pics around for years^ recently met someone online who knows the dude that took the pics
the guy flushed his entire stash not long after he took the pictures
Ahldagor
04-16-2014, 09:24 PM
yes because how does one explain the subject they are referring to if you don't add a possessive? Hi I'd like you to meet wife. Hi, this is a significant other with which I have attached feelings. Hi, this is a wife.
Hi, this is my wife.
You are overanalyzing the wrong stuff.
you could easily use their name instead of "my wife" or "a wife". that's what gets me.
there's also the public engagement aspect of it to consider. publicly, how does someone know if someone else is married or not if they don't communicate through the various ways they can?
is that where you are coming from tho?
mtb tripper
04-16-2014, 10:41 PM
http://i.imgur.com/ube5s7p.jpg
http://30.media.tumblr.com/tumblr_lih6whEzlO1qhj9apo1_500.jpg
seen these pics around for years^ recently met someone online who knows the dude that took the pics
the guy flushed his entire stash not long after he took the pictures
he could have given drugs to me instead of flushing :(
pharmakos
04-17-2014, 06:44 AM
even worse -- he flushed them because his girlfriend wanted him to do it
mtb tripper
04-17-2014, 06:42 PM
even worse -- he flushed them because his girlfriend wanted him to do it
noooooooooooo
Every tweaker knows you must put drugs before your girlfriend and loved ones, it's written in the handbook
mtb tripper
04-17-2014, 07:25 PM
http://www.youtube.com/watch?v=DDSAZp4sdGA
mtb tripper
04-17-2014, 07:25 PM
http://www.youtube.com/watch?v=DDSAZp4sdGA
nilzark
04-17-2014, 08:49 PM
You be trippin. MTB tripper.
mtb tripper
04-17-2014, 09:45 PM
You be trippin. MTB tripper.
always trippin
nilzark
04-17-2014, 09:55 PM
Do you actually play EQ or do you just get high and forum quest? Not judging.
mtb tripper
04-17-2014, 10:10 PM
Do you actually play EQ or do you just get high and forum quest? Not judging.
pretty much just forumquest and get high, I get on occasionally just to catch up on the bullshit
Zoesha
04-17-2014, 10:14 PM
http://static.fjcdn.com/pictures/Awww_88e419_1008287.jpg
wtf lmao
mtb tripper
04-18-2014, 08:21 PM
http://www.youtube.com/watch?v=EJqo90lNYLs
Fountree
04-18-2014, 08:35 PM
ITS FRIDAY NITE! LETS GET DOWN!!!
http://www.youtube.com/watch?v=l61MFiIeuVM
mtb tripper
04-18-2014, 08:45 PM
ITS FRIDAY NITE! LETS GET DOWN!!!
http://www.youtube.com/watch?v=l61MFiIeuVM
Wonderful song, may the weekend begin!
mtb tripper
04-18-2014, 11:06 PM
http://37.media.tumblr.com/54d1ac9ad7dd39390a43e712986953f8/tumblr_n3w2eqOtXI1raknvbo1_500.gif
Gaffin 7.0
04-19-2014, 12:10 AM
Stimulant abuse is prob one of the worst things ive done in my life, makes your brain all types of fucked for a long time, I use to be the total opposite honestly until I had tried cocaine and a few others, I loved downers, drugs that made you feel mellow and calm. Being paranoid every where you go sober is not cool. Lots of Valium help get over that shit for months.
pharmakos
04-19-2014, 10:45 AM
dissociatives are king imo
greenblze420
04-19-2014, 10:51 AM
noooooooooooo
Every tweaker knows you must put drugs before your girlfriend and loved ones, it's written in the handbook
every tweaker knows u dont even keep the GF around let alone flush your stash becuz of the dumb bitch... i mean really u could just give some bust downs a lil coke and ud be getting your dick sucked all night and dont even have 2 deal with bitching or anything fk bitchens get money and spend that money on drugs
mtb tripper
04-20-2014, 09:02 PM
every tweaker knows u dont even keep the GF around let alone flush your stash becuz of the dumb bitch... i mean really u could just give some bust downs a lil coke and ud be getting your dick sucked all night and dont even have 2 deal with bitching or anything fk bitchens get money and spend that money on drugs
exactly
mtb tripper
04-21-2014, 02:30 PM
I hope everyone had a great 420
DeruIsLove
04-21-2014, 03:48 PM
What the fuck. Just shut up, OD and die already.
Kurgateb, buy a packet of concentrated (25x or higher) salvia divinorum off the internets. Smoke 1 bowl full of it. Sit back and experience something every human being should experience at least once in their lifetime.
Then chill the fuck out and come back and post about your experience meeting sailor moon on the other side.
Shannacore
04-21-2014, 04:09 PM
Then chill the fuck out and come back and post about your experience meeting sailor moon on the other side.
lol'd
DeruIsLove
04-21-2014, 04:39 PM
experience something every human being should experience at least once in their lifetime.
That's the same line that the born again Christians try to use when they try to shove their Jesus experiences down others' throats.
I'll tell you what I tell them. I like my state of mind where it is fine thank you. Logical and unimpared by bullshit.
phacemeltar
04-21-2014, 04:46 PM
That's the same line that the born again Christians try to use when they try to shove their Jesus experiences down others' throats.
I'll tell you what I tell them. I like my state of mind where it is fine thank you. Logical and unimpared by bullshit.
reality is bullshit, man
DeruIsLove
04-21-2014, 04:48 PM
reality is bullshit, man
Being a hippy is not something to be proud about.
phacemeltar
04-21-2014, 04:50 PM
Being a hippy is not something to be proud about.
thanks for your opinion, dad of the 1950s.
phacemeltar
04-21-2014, 04:51 PM
i look forward to a world where someone can be what they want to be, and not have to worry about getting chastised by some zealot.
DeruIsLove
04-21-2014, 04:56 PM
I'm all for being what you want to be. Trying to drag others into your lifestyle is another thing altogether. You are no different than a good fearing sheep.
DeruIsLove
04-21-2014, 04:57 PM
God
Fuck Swype
phacemeltar
04-21-2014, 05:01 PM
baaaa
Orruar
04-21-2014, 05:08 PM
I'm all for being what you want to be. Trying to drag others into your lifestyle is another thing altogether. You are no different than a good fearing sheep.
Who is dragging someone?
Glenzig
04-21-2014, 05:10 PM
i look forward to a world where someone can be what they want to be, and not have to worry about getting chastised by some zealot.
What if they want to be a chastising zealot?
phacemeltar
04-21-2014, 05:19 PM
What if they want to be a chastising zealot?
theres a right answer to this, im sure
phacemeltar
04-21-2014, 05:30 PM
ok i got it.. took a few minutes to fire up the ol' braincells
anyone should be able to do or be as they choose, but it is illogical for them to expect respect from others that they can not themselves give.
therefore, its fine if one wants to be a chastising zealot, but they should expect to be judged harshly for it.
DeruIsLove
04-21-2014, 05:33 PM
You have it the wrong way around. It's fighting fire with fire. I'm the one being told to fuck myself up because it's an experience that 'every human being should have'. I'm resisting peer(stretch) pressure to do so and backing up my statements via example. Pace can only come of war.
DeruIsLove
04-21-2014, 05:35 PM
Peace. Double fuck Swype
phacemeltar
04-21-2014, 05:43 PM
you are using experiences that are not your own in order to justify your argument
That's the same line that the born again Christians try to use when they try to shove their Jesus experiences down others' throats.
I'll tell you what I tell them. I like my state of mind where it is fine thank you. Logical and unimpared by bullshit.
I'm all for being what you want to be. Trying to drag others into your lifestyle is another thing altogether. You are no different than a good fearing sheep.
This is weak reasoning. I think you just want to be contrary.
Hallucinogens were something I deeply enjoyed for their own sake, not any associated lifestyle or culture. I'd encourage someone to try them like I would ice cream or blow jobs, because those things are pretty great.
During our time on this Earth, there is nothing quite like temporarily altering your entire state of existence. If you're logical or intellectually curious, then I'm sure you could appreciate the novelty of that kind of experience. There is no need to sperg out about 'lifestyles', that shit is irrelevant. We view our entire reality through a very specific type of lens. Your lens is a little different than mine because you're autistic, but that's okay. Entheogens give you the opportunity to briefly change that lens and perceive your existence in a different way.
Think of it like you would skiing or sex with a 14 year old japanese schoolgirl; it's just an enjoyable, meaningful activity.
Also I wouldn't buy into the commonly held misconceptions about hallucinogens fucking you up. Same kind of shit as the state telling you "Don't inject so many marijuanas or you'll get addicted and die of an OD". Salvia divinorum is completely harmless, as is psilocybin. Some studies have suggested they may rarely contribute to triggering underlying, pre-existing psychoses, but the evidence is weak. Have you ever imbibed alcohol and gotten drunk? The harmful effects of that substance are exponentially more harmful than almost any hallucinogen.
mtb tripper
04-21-2014, 05:49 PM
Kurgateb, buy a packet of concentrated (25x or higher) salvia divinorum off the internets. Smoke 1 bowl full of it. Sit back and experience something every human being should experience at least once in their lifetime.
Then chill the fuck out and come back and post about your experience meeting sailor moon on the other side.
reality is bullshit, man
thanks for your opinion, dad of the 1950s.
i look forward to a world where someone can be what they want to be, and not have to worry about getting chastised by some zealot.
This is weak reasoning. I think you just want to be contrary.
Hallucinogens were something I deeply enjoyed for their own sake, not any associated lifestyle or culture. I'd encourage someone to try them like I would ice cream or blow jobs, because those things are pretty great.
During our time on this Earth, there is nothing quite like temporarily altering your entire state of existence. If you're logical or intellectually curious, then I'm sure you could appreciate the novelty of that kind of experience. There is no need to sperg out about 'lifestyles', that shit is irrelevant. We view our entire reality through a very specific type of lens. Your lens is a little different than mine because you're autistic, but that's okay. Entheogens give you the opportunity to briefly change that lens and perceive your existence in a different way.
Think of it like you would skiing or sex with a 14 year old japanese schoolgirl; it's just an enjoyable, meaningful activity.
Also I wouldn't buy into the commonly held misconceptions about hallucinogens fucking you up. Same kind of shit as the state telling you "Don't inject so many marijuanas or you'll get addicted and die of an OD". Salvia divinorum is completely harmless, as is psilocybin. Some studies have suggested they may rarely contribute to triggering underlying, pre-existing psychoses, but the evidence is weak. Have you ever imbibed alcohol and gotten drunk? The harmful effects of that substance are exponentially more harmful than almost any hallucinogen.
mtb tripper
04-21-2014, 05:50 PM
The wisdom of Lune and phacemeltar
Champion_Standing
04-21-2014, 05:55 PM
https://www.youtube.com/watch?v=6u5tQ3tqp04
DeruIsLove
04-21-2014, 06:05 PM
This is weak reasoning. I think you just want to be contrary.
Hallucinogens were something I deeply enjoyed for their own sake, not any associated lifestyle or culture. I'd encourage someone to try them like I would ice cream or blow jobs, because those things are pretty great.
During our time on this Earth, there is nothing quite like temporarily altering your entire state of existence. If you're logical or intellectually curious, then I'm sure you could appreciate the novelty of that kind of experience. There is no need to sperg out about 'lifestyles', that shit is irrelevant. We view our entire reality through a very specific type of lens. Your lens is a little different than mine because you're autistic, but that's okay. Entheogens give you the opportunity to briefly change that lens and perceive your existence in a different way.
Think of it like you would skiing or sex with a 14 year old japanese schoolgirl; it's just an enjoyable, meaningful activity.
Also I wouldn't buy into the commonly held misconceptions about hallucinogens fucking you up. Same kind of shit as the state telling you "Don't inject so many marijuanas or you'll get addicted and die of an OD". Salvia divinorum is completely harmless, as is psilocybin. Some studies have suggested they may rarely contribute to triggering underlying, pre-existing psychoses, but the evidence is weak. Have you ever imbibed alcohol and gotten drunk? The harmful effects of that substance are exponentially more harmful than almost any hallucinogen.
Take it as you will, you are one of my favorite posters on these boards. I tend to generalize and for that I apologize if I lumped you in with the likes of Pharma, MTB, or facemelter.
If I wasn't typing this on a phonefI'd elaborate more. That said, I don't disagree with you on any single point. What I disagree with is the glorification of such ideals, which again I'm not pointing my finger at you specifically.
I tried drinking a bit back in my teen years, didn't do anything for me, haven't consumed alcohol in over s decade and I'm certain I'm better for it.
As for the 14 year old comment, it's annoying. My girlfriend is 21 and we have a 25 year old on and off fuck buddy. There is no desire for young girls, there isn't going to be.
phacemeltar
04-21-2014, 06:20 PM
or facemelter.
ugh, what did i do!
DeruIsLove
04-21-2014, 06:27 PM
ugh, what did i do!
Something along the lines of constantly bouncing back and forth between trolling and the acid trip equivalent of 'smoke weed erry day'.
phacemeltar
04-21-2014, 06:29 PM
hay hay hay hay
mtb tripper
04-21-2014, 07:30 PM
and a god/God/gawwwralfamafatakeenoneemaneeweewoo said let there be darkness and hell. all hail satan
Ahldagor
04-21-2014, 08:18 PM
satan's no more than the god-sanctioned tester of faith. belial is where the fun is.
Champion_Standing
04-21-2014, 08:53 PM
I heard smoking drugs turns you into a pedophile, a rapist and a werewolf
greenblze420
04-21-2014, 10:50 PM
cocaine without baking soda just isnt the same
pharmakos
04-22-2014, 12:21 AM
passed my drug test, got the job
pharmakos
04-22-2014, 12:23 AM
Take it as you will, you are one of my favorite posters on these boards. I tend to generalize and for that I apologize if I lumped you in with the likes of Pharma, MTB, or facemelter.
Something along the lines of constantly bouncing back and forth between trolling and the acid trip equivalent of 'smoke weed erry day'.
you seem like the type of person that takes life too seriously
pharmakos
04-22-2014, 12:25 AM
Trying to drag others into your lifestyle is another thing altogether.
you don't want none of this dewey cox (https://www.youtube.com/watch?v=X0MXhsRxJXQ)
pharmakos
04-22-2014, 12:27 AM
but naw for real i don't think anyone should get into the things i'm into, to the point where i refuse to sell to anyone and i refuse to share my sources with anyone
mtb tripper
04-22-2014, 11:04 PM
satan's no more than the god-sanctioned tester of faith. belial is where the fun is.
I've really had the urge to communicate with the illuminated images of demons within my brain while on psychedelics
mtb tripper
04-22-2014, 11:51 PM
https://24.media.tumblr.com/2080f4ee3b1e498fe0a0d9f96eb616cd/tumblr_n3tsgumCKg1s28gwqo1_500.jpg
http://www.youtube.com/watch?v=XEJk53CRubA
mtb tripper
04-23-2014, 02:40 PM
http://24.media.tumblr.com/tumblr_lq1zwwYkSe1qaccepo1_1280.jpg
http://24.media.tumblr.com/ec2fe07122e2d4eec54c12989604a3ff/tumblr_n4gw7gVoFx1r7ahfto1_1280.jpg
http://24.media.tumblr.com/780052b78e2067533cc6316185f679bc/tumblr_n42y1ljea61r4fmxfo1_r2_400.gif
http://31.media.tumblr.com/157266c7ae776516bcef86b4509c6357/tumblr_n3yxbwz1iT1qhrim2o1_500.gif
http://37.media.tumblr.com/21115f2d15c40d826da56d376a537fc7/tumblr_n4hj8ehuOM1sjtytuo1_400.gif
http://37.media.tumblr.com/01fbdd3050566e5415a4a683ad4af6ba/tumblr_myy8gjCSN21sf5q9yo1_400.gif
mtb tripper
04-23-2014, 08:02 PM
http://cdn.makeagif.com/media/4-23-2014/qVz0Sg.gif
mtb tripper
04-24-2014, 01:48 PM
who likes meth
phacemeltar
04-24-2014, 01:55 PM
who likes meth
people who's dentists hate them
phacemeltar
04-24-2014, 02:00 PM
whose*
Ahldagor
04-24-2014, 02:10 PM
I've really had the urge to communicate with the illuminated images of demons within my brain while on psychedelics
http://www.amazon.com/The-Goetia-Lemegeton-Clavicula-Salomonis/dp/087728847X/ref=sr_1_1?ie=UTF8&qid=1398362974&sr=8-1&keywords=ars+goetia
Dragonsblood1987
04-24-2014, 02:17 PM
satan's no more than the god-sanctioned tester of faith. belial is where the fun is.
Belial is the hebrew word for "a worthless man". Doesnt show up in the bible, and was one of the angels who rebelled against god in "paradise lost". I dont see where theres much fun in that..
Mephistopheles on the other hand. That guys a hoot.
mtb tripper
04-24-2014, 02:22 PM
http://www.amazon.com/The-Goetia-Lemegeton-Clavicula-Salomonis/dp/087728847X/ref=sr_1_1?ie=UTF8&qid=1398362974&sr=8-1&keywords=ars+goetia
I think I am actually going to get this, have you read it yet?
phacemeltar
04-24-2014, 02:30 PM
http://lindsayhancock.com/wp-content/uploads/2014/04/girl-smoking-smoke-weed-marijuana-joint-vape-supermodel-model-capnolagnia.jpg
Ahldagor
04-24-2014, 02:40 PM
I think I am actually going to get this, have you read it yet?
years ago. it's worth it if you're interested in the content. my mom's a practicing wiccan, so she has some weird shit laying around her house.
mtb tripper
04-24-2014, 02:44 PM
That's badass, I'm going to get it I think, sounds very interesting.
And that is one sexy woman Mr. Phacemeltar
Ahldagor
04-24-2014, 02:49 PM
Belial is the hebrew word for "a worthless man". Doesnt show up in the bible, and was one of the angels who rebelled against god in "paradise lost". I dont see where theres much fun in that..
Mephistopheles on the other hand. That guys a hoot.
the sons of eli were worthless men because the family succumbed to belial's influence.
mtb tripper
04-25-2014, 11:16 AM
scrounging through garbage cans behind office depot hoping to find a printer that had to be thrown out due to messed up packaging, hoping to trade for a little rock
mtb tripper
04-26-2014, 10:22 PM
humanity
mtb tripper
04-26-2014, 11:00 PM
http://www.youtube.com/watch?v=7IaPtrmGCHA
mtb tripper
04-27-2014, 10:48 AM
thank god for mental illness
pharmakos
04-27-2014, 03:18 PM
gerge carlin - sometimes a little brain damage can help
phacemeltar
04-29-2014, 01:30 AM
The first plateau TThhee ffiirrsstt ppllaatteeaauu The first plateau
DXM - Drugs Forum http://www.drugs-forum.com/forum/showwiki.php?title=DXM
5 of 31 4/27/2014 9:48 PM
[top]
[top]
[top]
The first DXM plateau is achieved at a dose of 1.5 – 2.5 mg/kg. A first plateau dose is somewhat similar to a medium dose of alcohol .
Mild effects are usually experienced. They include slightly altered kinesthetic sense, music euphoria, stimulation, general mood lift, slight intoxication, lowered inhibitions (may be positive or negative, depending on the situation) and some difficulties in talking (stuttering, not being able to find the right words). Memory effects are usually not noticeable, although some may have some difficulty with short-term memory and learning.
Dancing and listening to music are generally enjoyable. Dancing and other physical activities should not be overdone.
The second plateau TThhee sseeccoonndd ppllaatteeaauu The second plateau
The second DXM plateau ranges between dosages of 2.5 and 7.5 mg/kg. It is similar to the first plateau and is characterized by more pronounced effects.
General effects include stronger intoxication, double vision, stronger alteration of kinesthetic sense, feelings of separation to reality (most users are still able to maintain constant contact to reality at this dosage), sensation of floating and closed-eye visuals. Short-term memory is impaired, often to a significant degree. Most users are still able to conduct conversations.
The third plateau TThhee tthhiirrdd ppllaatteeaauu The third plateau
The dosage for the third DXM plateau ranges between 7.5 and 15 mg/kg. The effects of a third plateau experience mainly consist of stronger second plateau effects, with significantly more dissociation.
The effects include complete loss of stereoscopic vision (complete double vision), periods of total disconnection from reality, flanging of the perception of time and strong intoxication. Memory and other cognitive abilities are strongly impaired, reaction speed is greatly reduced. Self-awareness is heavily impaired (their own actions may seem distant to users). Panic attacks may happen, especially to inexperienced users.
The upper DXM plateaus (third, fourth and Sigma) are generally very intense and can be overpowering for many users, especially those inexperienced with dissociatives . Cognitive and motor skills are significantly impaired at upper plateau doses. Users should never be in public or engage in potentially dangerous activities. The presence of a trip sitter is essential, especially if the user has no experience with a particular dose.
The fourth plateau TThhee ffoouurrtthh ppllaatteeaauu The fourth plateau
The fourth DXM plateau (15-17 mg/kg) is marked by complete dissociation of the mind from the body.
The effects of the fourth plateau resemble those of full dissociative anaesthesia. Self-awareness may subside to zero; users don't have any contact to their own body.
These effects are likely to be too intense to many users. Having no or very little awareness of reality, users are generally unable to react to emergencies, which is why a sober assistant needs to be present. Because users are usually not able to control their body and react to emergencies, a sober trip assistant needs to be present.
DXM - Drugs Forum http://www.drugs-forum.com/forum/showwiki.php?title=DXM
6 of 31 4/27/2014 9:48 PM
[top]
[top]
Plateau Sigma PPllaatteeaauu SSiiggmmaa Plateau Sigma
Plateau Sigma is reached by prolonging DXM intake. Plateau Sigma can be achieved by taking a low second plateau dose, then one hour after the peak taking another second plateau dose, and one hour after the second peak taking a high second plateau or a low third plateau dose.
After the third plateau experience diminishes, one is left in plateau Sigma. Open-eye visual hallucinations and psychosis-like effects may be experienced. Thoughts become very abstract and users aren't capable of doing any intellectual task.
To most users, the plateau Sigma experience is very unpleasant or too powerful to be repeated. Again, the presence of a trip sitter is vital.
ugh screw DXM in the face
Some of that came into my area when I was right out of highschool, worst got damn drug of all time if you weren't careful. iirc don't drink ANY alcohol, make sure you have a full stomach, i think weed has bad effects with it as well.
Took it a few times, first i mixed with alcohol, just a smidge, felt the most sloppiest drunk i've ever felt and gravity was going upside down and backwards.
The other time was better and I just thought i was a lizard and hung out in some dudes yard for a while.
thought i was a lizard and hung out in some dudes yard for a while.
sweet jesus reading what i just wrote, not sure how i lived into my 20's. :(
phacemeltar
04-29-2014, 01:41 AM
Took it a few times, first i mixed with alcohol, just a smidge, felt the most sloppiest drunk i've ever felt and gravity was going upside down and backwards.
ive been doing some reading up on the stuff, as i enjoy doing legal drugs, and it turns out that alcohol will reduce the effect of DXM on the system.
from that same page:
Alcohol Small amounts are said to potentiate DXM and ‘take the edge off’ (reduce stimulation and anxiety). When DXM is consumed together with alcohol (prefferably dissolved in it), absorption takes place more quickly, resulting in a shorter onset, higher peak and overall shorter duration. Large amounts may aggravate nausea and respiratory depression. See dangerous combinations .
pharmakos
04-29-2014, 04:03 AM
i've done way too much DXM in my lifetime. any questions tho, just ask.
Softcore PK
04-29-2014, 08:21 PM
Anyone know how long etizolam is detectable in urine? I know it's an analogue but a false positive could be problematic. Even just half life would be good infoz.
Ahldagor
04-29-2014, 09:30 PM
Anyone know how long etizolam is detectable in urine? I know it's an analogue but a false positive could be problematic. Even just half life would be good infoz.
http://www.erowid.org/general/big_chart.shtml
Aviann
04-29-2014, 09:39 PM
http://www.erowid.org/general/big_chart.shtml
holy fuck thank you
Ahldagor
04-29-2014, 09:41 PM
holy fuck thank you
bitte
mtb tripper
04-29-2014, 11:19 PM
erowid to the rescue
mtb tripper
04-29-2014, 11:55 PM
They're gonna talk about individual freedom, but when they see a free individual, its gonna scare em
http://www.youtube.com/watch?v=8Gu2ouJNmXc
Godefroi
04-30-2014, 05:18 AM
http://www.liveleak.com/view?i=3b4_1398700854
don't do LSD in the desert :)
Ahldagor
04-30-2014, 02:14 PM
freedom isn't real, and the desert is one of the best places to trip in. burning man 08
Ahldagor
04-30-2014, 02:15 PM
beach is good too. especially if you pay attention to the tidal transition. there is no stillness.
mtb tripper
04-30-2014, 02:35 PM
freedom isn't real, and the desert is one of the best places to trip in. burning man 08
I really want to experience burning man
Ahldagor
04-30-2014, 02:54 PM
I really want to experience burning man
it's worth it.
Ahldagor
04-30-2014, 02:57 PM
also, don't go into it with a notion of experience as a type of consumption.
mtb tripper
04-30-2014, 03:32 PM
also, don't go into it with a notion of experience as a type of consumption.
what do you mean, like I should enjoy more than just the drugs? of course
Ahldagor
04-30-2014, 03:45 PM
what do you mean, like I should enjoy more than just the drugs? of course
no. having a notion that by going to burning man it makes you something because you've done it. it's like you can't drink a certain coffee, wear certain clothes, eat at certain restaurants and become whatever it is that you're trying to be. the best part is meeting and conversing with strangers. when the event becomes secondary then you've unlocked the great joke of burning man.
mtb tripper
04-30-2014, 04:12 PM
no. having a notion that by going to burning man it makes you something because you've done it. it's like you can't drink a certain coffee, wear certain clothes, eat at certain restaurants and become whatever it is that you're trying to be. the best part is meeting and conversing with strangers. when the event becomes secondary then you've unlocked the great joke of burning man.
ahhhhh I see
mtb tripper
05-02-2014, 12:45 PM
Prozac vs Heroin
pharmakos
05-03-2014, 12:04 AM
beer is a drug
so is caffeine
Ahldagor
05-03-2014, 02:15 PM
http://www.funnyordie.com/videos/834e452cf0/chappelle-show-kneehigh-park-from-thaffner
Herpa Derp
05-03-2014, 06:32 PM
Lots of black tar in my area, I'm wondering if anyone knows where it's coming from? Everyone tells me it's local guys but idk with all of the afghan shit in LA. It's good stuff at least.
captnamazing
05-03-2014, 07:58 PM
lol @ ppl who say dont do drug dont u relise beer cofee cigaretten even water air are all drug type
pharmakos
05-03-2014, 08:51 PM
some of the most damaging drugs are given to you with your doctor endorsing them. i've had a lot of loved ones struggle with addiction / withdrawal from legally prescribes benzodiazepines, opiates/opioids, and antidepressants.
Herpa Derp
05-04-2014, 05:33 PM
some of the most damaging drugs are given to you with your doctor endorsing them. i've had a lot of loved ones struggle with addiction / withdrawal from legally prescribes benzodiazepines, opiates/opioids, and antidepressants.
I've met more heroin addicts that started out on prescriptions than anything else.
mtb tripper
05-04-2014, 10:30 PM
http://www.satansheaven.com/animated_gif_pentagram-Datei/pent6satanshimmel.gif
radditsu
05-04-2014, 11:11 PM
Satan must hate hotlinks.
radditsu
05-04-2014, 11:11 PM
Satan takes bandwidth theft seriously. Your blood is forefit.
mtb tripper
05-04-2014, 11:32 PM
Satan takes bandwidth theft seriously. Your blood is forefit.
the goat is dead, but we can still do this thing, I'll cut ya a deal
radditsu
05-05-2014, 12:22 AM
I have my minion. I need not your service worm.
https://encrypted-tbn3.gstatic.com/images?q=tbn:ANd9GcTUhqKwNylQ726sr64nvUhkpl9xVHcBz DrbmLCdgQc6afW5GlHmtRUywYQ
Champion_Standing
05-05-2014, 12:29 AM
Satan must hate hotlinks.
Prohibiting hotlinks is one of the founding tenets of Satanism.
mtb tripper
05-05-2014, 12:32 AM
Prohibiting hotlinks is one of the founding tenets of Satanism.
mtb tripper
06-09-2014, 07:53 PM
a long trip
DeruIsLove
06-09-2014, 08:01 PM
You're still alive.
Fuck. :(
mtb tripper
06-09-2014, 08:04 PM
You're still alive.
Fuck. :(
love you too deru
DeruIsLove
06-09-2014, 08:33 PM
:)
mtb tripper
06-12-2014, 07:53 PM
go watch stoned, on netflix.
Fountree
06-13-2014, 02:42 PM
http://www.youtube.com/watch?v=F85QhduQCXM
Fountree
06-13-2014, 02:43 PM
http://www.youtube.com/watch?v=Wi0e7brHdMQ
hey junkies, I just inherited about 200 30mg morphine sulfate ertabs
What's the best approach? put them in my butt?
pharmakos
06-14-2014, 02:04 PM
i would probably chew up two at a time with two tums (tums raises your stomach's pH and increases absorption)
followed by two stool softener pills, because i hate the constipation that opiates cause
mtb tripper
06-17-2014, 03:50 AM
http://www.youtube.com/watch?v=Wi0e7brHdMQ
never heard of these guys before, as soon as i heard that opening guitar though I was hooked. Real groovy man, thanks for sharing.
Also, that stones song is great, their satanic majesties request is my favorite stones album by far.
abacab-bansdontwork
06-17-2014, 05:37 AM
https://www.youtube.com/watch?v=k5zntaS0kzM
mtb tripper
06-17-2014, 11:58 PM
Psilocybia
mtb tripper
06-20-2014, 02:24 PM
hello darkness my old friend, I've come to vlafffaad;flahskdjgfhlaasd
Ahldagor
06-20-2014, 02:34 PM
http://www.youtube.com/watch?v=iZ8nN6hTnmM
http://www.youtube.com/watch?v=C4YEJcR0-EE
http://www.youtube.com/watch?v=fP6IOM4qcYk
fadetree
06-20-2014, 02:44 PM
Kava. Kratom. Both good clean fun. Kratom's addictive sorta if you are a compulsive tho.
Ahldagor
06-20-2014, 02:48 PM
kratom helps the opiate addicts
mtb tripper
06-20-2014, 04:20 PM
Chewing up painkillers is amateur white trash junkie shit.
Boone county mating call!!! yeeedawgy
mtb tripper
06-20-2014, 06:37 PM
https://www.youtube.com/watch?v=eTb5GePMPKY
Fountree
06-20-2014, 07:12 PM
For the hip-hop fans in this thread, the most party-est/psychedelic rap album of all time:
http://www.youtube.com/watch?v=DxCCaOjZS_g
Fountree
06-20-2014, 07:14 PM
https://www.youtube.com/watch?v=eTb5GePMPKY
Have you picked up "Revelations" yet MTB? Just released BJM. Considering dropping the 42 bones on the vinyl not sure if its worth it though...
Fountree
06-20-2014, 07:19 PM
For the hip-hop fans in this thread, the most party-est/psychedelic rap album of all time:
http://www.youtube.com/watch?v=DxCCaOjZS_g
By the way, the beginning of this link is fucked, skip a couple mins in...
mtb tripper
06-21-2014, 05:38 AM
Have you picked up "Revelations" yet MTB? Just released BJM. Considering dropping the 42 bones on the vinyl not sure if its worth it though...
yes man, 100% worth the vinyl. Do not buy it otherwise, it will ruin the experience. Make sure you take some drugs or get extra blazed too. "What you isn't" is probably my favorite track on there.
mtb tripper
06-21-2014, 05:41 AM
Have you picked up "Revelations" yet MTB? Just released BJM. Considering dropping the 42 bones on the vinyl not sure if its worth it though...
Definitely nothing like any of their other albums, very innovative.
pharmakos
06-22-2014, 04:47 AM
Two tums isn't going to make a damn bit of difference. pKa difference is such that even if you did manage to raise the pH of your stomach, you're still only going to protonate 1 in every 10000000 molecules. And that's not going to influence the absorption.
Beside that, hepatic metabolism is horrible. Chewing up painkillers is amateur white trash junkie shit.
to be honest, the opiates + tums for potentiation thing is a common technique that i have heard enough times that i never bothered to verify if it was true. doing some googling around, it seems that raising stomach pH may or may not affect opiate absorption. one source even said that it can decrease bioavailability.
if it is indeed just an urban legend, its roots may come from the fact that a different class of antacids actually do potentiate many opiates. cimetidine (otc trade name tagamet) does not attempt to directly raise stomach ph, but rather inhibits stomach acid production. cimetidine happens to be a CYP2D6 inhibitor, the liver enzyme that metabolizes many common opiates... thus prolonging the high.
mtb tripper
06-22-2014, 05:23 AM
http://nunzioweb.com/kaleidoscope.htm
https://www.youtube.com/watch?v=A3ZzqD6FD-o
thugcruncher
06-22-2014, 06:31 AM
http://25.media.tumblr.com/59a58ff10d944ce0a18fdb37e0f475e9/tumblr_miyskp6XuD1rayufwo1_250.jpg
Champion_Standing
06-22-2014, 09:01 AM
"First you have to realize that you are in prison, which is what my first mushroom trip ascertained for me with absolute certainty. I looked back at all the years that I had taken it all so "seriously" and thought 'my god, didn't I have any clue?' 'Did i spend 30 years taking part in some mass psychosis?'"
mtb tripper
06-22-2014, 03:46 PM
"First you have to realize that you are in prison, which is what my first mushroom trip ascertained for me with absolute certainty. I looked back at all the years that I had taken it all so "seriously" and thought 'my god, didn't I have any clue?' 'Did i spend 30 years taking part in some mass psychosis?'"
Chemical programming
mtb tripper
06-22-2014, 05:07 PM
http://dzasv7x7a867v.cloudfront.net/product_photos/1230203/limbus_original.jpg
pharmakos
06-22-2014, 06:16 PM
Fucking with liver function is a terrible idea. The impact on drug metabolism is going to be marginal at best, and is going to be proportional to how badly you're fucking with your liver's ability to yoink toxins from the blood.
All of these approaches lack any common sense whatsoever. If you're going to do anything, a simple extraction would be the least retarded approach with the most benefit for the amount of effort involved.
dude i just want to be high and dumb and play everquest
if you want to do the education and harm reduction schtick and fap over how much you know about biochemistry take it over to http://bluelight.org
here are two good threads http://www.bluelight.org/vb/threads/598070-The-Big-and-Bangin-Pseudo-Advanced-Drug-Chemistry-Pharmacology-and-More-Thread-V-2
http://www.bluelight.org/vb/threads/582708-I-like-to-draw-pictures-of-random-molecules
if you loved it you should have put a methylenedioxy ring on it
pharmakos
06-22-2014, 06:17 PM
http://imgs.xkcd.com/comics/ld50.png
Youlath
06-22-2014, 11:40 PM
the only drug worth doing is LSD
pharmakos
06-23-2014, 12:04 AM
uthgaard strikes as the type of person that isn't very fun to do drugs with.
mtb tripper
06-25-2014, 02:19 AM
continue on flower children.
http://www.youtube.com/watch?v=Q1L11Y0I5E0
Shit's rad
radda
06-25-2014, 02:35 AM
tree, shrooms, and dmt.
alcohol, acid and cigs to fill the gaps.
thats me
radda
06-25-2014, 02:37 AM
oh, and i guess i wouldnt be telling the whole truth is i didnt say i take pain pills and
once dabbled in robo-tripping . but i rather not
mtb tripper
06-25-2014, 03:24 AM
oh, and i guess i wouldnt be telling the whole truth is i didnt say i take pain pills and
once dabbled in robo-tripping . but i rather not
https://www.youtube.com/watch?v=eiBVQ8MnS_A
baddddd triippppppppp SATANRAFLAMAFDARKNESSSSSEVIIILLLLRAPEMURDERRRPILLA GEEVERYTHINGCONSIDEREDEVIL
Ikonoclastia
06-25-2014, 03:43 AM
Steroids, they'll tell you they're bad and all that stuff but its rubbish.... used them non-stop since 2007 and I'm a shit ton fitter and younger looking then most guys my age (41).
Will stop when I'm dead...
mtb tripper
06-25-2014, 02:11 PM
Steroids, they'll tell you they're bad and all that stuff but its rubbish.... used them non-stop since 2007 and I'm a shit ton fitter and younger looking then most guys my age (41).
Will stop when I'm dead...
how about your nuts?
Ikonoclastia
06-26-2014, 04:53 AM
how about your nuts?
They don't change. I have a friend though his have disappeared apparently so I guess its individual thing.
Ikonoclastia
06-26-2014, 05:06 AM
Only real sides I have is scar tissue from the proprionate. That only occurs because I mostly use stock testosterone since steroids are illegal here and the stock steroids use proprionate as a base ester which causes inflammation and scaring.
If I could legally get enanthate that' wouldn't be a problem. The good news is a couple of weeks ago I saw on the news that they're now doing trials in the US on supra physiological amounts of steroids on older people and it seems possible they're starting to realise the benefits instead of the usual hysteria about cancer, brain tumours and roid rage.
I'm sterile though but that's a good thing. Wife doesn't have to take pill and its reversible if I stop.
Ahldagor
06-26-2014, 02:59 PM
lol it's the long term usage that causes those. they've been giving short term steroids to the elderly for decades because it does help them. most people that are younger are looking for that quick way out because that's convenient and folks are lazy and impatient with little discipline unless there's an additional substance involved. co-dependency isn't a good thing.
mtb tripper
06-28-2014, 05:28 PM
go and eat some acid out in nature on a beautiful day, communicate with the plants, insects, clouds, and listen to this in deep meditation. Life changing to say the least.http://www.youtube.com/watch?v=mJP9_HpSpwc
mtb tripper
06-30-2014, 07:57 PM
boxcar willy
Fountree
06-30-2014, 08:09 PM
go and eat some acid out in nature on a beautiful day, communicate with the plants, insects, clouds, and listen to this in deep meditation. Life changing to say the least.http://www.youtube.com/watch?v=mJP9_HpSpwc
Thank you
mtb tripper
06-30-2014, 09:20 PM
Thank you
you know it :D
mtb tripper
07-02-2014, 03:33 AM
uncle sam sends his regards
mtb tripper
07-02-2014, 07:17 AM
http://www.youtube.com/watch?v=JitHrPXpRYw
Orruar
07-02-2014, 09:56 AM
instead of the usual hysteria about cancer, brain tumours and roid rage.
Rustled Jimmy Syndrome is no hysteria.
http://beta.southpark.de/fans/downloads/15fa0c1c-736e-495a-9198-58a2cf43b662/?type=image
mtb tripper
07-02-2014, 09:41 PM
good ol jimmy
Zadrian
07-02-2014, 09:44 PM
I've always wanted to try some peyote
Zadrian
07-02-2014, 09:46 PM
I mean, if it's anything like this...
https://www.youtube.com/watch?v=PKYUz7kx3jA&feature=kp
mtb tripper
07-02-2014, 09:50 PM
I mean, if it's anything like this...
https://www.youtube.com/watch?v=PKYUz7kx3jA&feature=kp
im sure if you wanted it to be it could be like that. Theres a reason all those native americans had faith in the gods and spirits and shit.
http://25.media.tumblr.com/59a58ff10d944ce0a18fdb37e0f475e9/tumblr_miyskp6XuD1rayufwo1_250.jpg
fukken saved
Strifer
07-02-2014, 10:14 PM
http://image.blingee.com/images19/content/output/000/000/000/7a7/763231022_242453.gif
pharmakos
07-03-2014, 12:19 AM
I've always wanted to try some peyote
could always get some san pedro (http://en.wikipedia.org/wiki/Echinopsis_pachanoi) instead
Nuktari
07-03-2014, 06:30 PM
I got yo drugz
all day long.
mtb tripper
07-10-2014, 06:54 PM
https://www.youtube.com/watch?v=Lyiqaxhk5WA
mtb tripper
07-10-2014, 06:56 PM
http://37.media.tumblr.com/2080f4ee3b1e498fe0a0d9f96eb616cd/tumblr_mnru1nzpa71qg6d7mo1_500.jpg
Sidelle
07-10-2014, 07:15 PM
http://31.media.tumblr.com/48835f7443689868eb015988c5a9f785/tumblr_mh5virdeMm1rpduwho1_500.gif
PSA: drugs are fun. that is all.
Chambers12
07-10-2014, 07:35 PM
What is drug?
mtb tripper
07-10-2014, 09:22 PM
I heard smoking drugs turns you into a pedophile, a rapist and a werewolf
pharmakos
07-10-2014, 11:44 PM
What is drug?
whoa man that's a deep question
Ahldagor
07-11-2014, 02:18 AM
drug
drəg/
noun
noun: drug; plural noun: drugs
1.
a medicine or other substance which has a physiological effect when ingested or otherwise introduced into the body.
"a new drug aimed at sufferers from Parkinson's disease"
synonyms: medicine, medication, medicament, pharmaceutical; More
remedy, cure, antidote
"drugs prescribed by doctors"
a substance taken for its narcotic or stimulant effects, often illegally.
"a drug addict"
synonyms: narcotic, stimulant, hallucinogen; More
informaldope
"she was under the influence of drugs"
verb
verb: drug; 3rd person present: drugs; past tense: drugged; past participle: drugged; gerund or present participle: drugging
1.
administer a drug to (someone) in order to induce stupor or insensibility.
"they were drugged to keep them quiet"
synonyms: anesthetize, narcotize; More
poison;
knock out, stupefy;
informaldope
"he was drugged"
add drugs to, tamper with, adulterate, contaminate, lace, poison;
informaldope, spike, doctor
"she drugged his coffee"
stupefied, insensible, befuddled;
delirious, hallucinating, narcotized;
anesthetized, knocked out;
informalstoned, coked, high (as a kite), doped, tripping, spaced out, wasted, wrecked, blitzed, baked
"they found Tom and his drugged friends camped out in the living room"
antonyms: sober
add a drug to (food or drink).
"he drugged their coffee"
informal
take illegally obtained drugs.
"fifteen years of drinking and drugging"
mtb tripper
07-11-2014, 06:37 AM
nice ^
phacemeltar
07-11-2014, 07:26 AM
http://38.media.tumblr.com/621e15ecc8f517a1d93cb247106241eb/tumblr_mhh4r6cM7J1qz6f9yo1_r1_500.jpg
phacemeltar
07-11-2014, 07:26 AM
http://38.media.tumblr.com/08a8a4dbfec5b466d6bc15d13af6f205/tumblr_mhh4r6cM7J1qz6f9yo3_r1_500.jpg
phacemeltar
07-11-2014, 07:27 AM
http://38.media.tumblr.com/8599a1dfb4b0c335340b16c39a6a549b/tumblr_mhh4r6cM7J1qz6f9yo2_r1_500.jpg
Chambers12
07-11-2014, 12:26 PM
drug
drəg/
noun
noun: drug; plural noun: drugs
1.
a medicine or other substance which has a physiological effect when ingested or otherwise introduced into the body.
"a new drug aimed at sufferers from Parkinson's disease"
synonyms: medicine, medication, medicament, pharmaceutical; More
remedy, cure, antidote
"drugs prescribed by doctors"
a substance taken for its narcotic or stimulant effects, often illegally.
"a drug addict"
synonyms: narcotic, stimulant, hallucinogen; More
informaldope
"she was under the influence of drugs"
verb
verb: drug; 3rd person present: drugs; past tense: drugged; past participle: drugged; gerund or present participle: drugging
1.
administer a drug to (someone) in order to induce stupor or insensibility.
"they were drugged to keep them quiet"
synonyms: anesthetize, narcotize; More
poison;
knock out, stupefy;
informaldope
"he was drugged"
add drugs to, tamper with, adulterate, contaminate, lace, poison;
informaldope, spike, doctor
"she drugged his coffee"
stupefied, insensible, befuddled;
delirious, hallucinating, narcotized;
anesthetized, knocked out;
informalstoned, coked, high (as a kite), doped, tripping, spaced out, wasted, wrecked, blitzed, baked
"they found Tom and his drugged friends camped out in the living room"
antonyms: sober
add a drug to (food or drink).
"he drugged their coffee"
informal
take illegally obtained drugs.
"fifteen years of drinking and drugging"
Very nice :D
Ahldagor
07-11-2014, 01:43 PM
that comic is lulz
phacemeltar
07-12-2014, 04:36 AM
trip out, traveler (http://www.drugs-plaza.com/pictures/wallpapers_with_drugs/animated-gifs/wos1.htm)
DetroitVelvetSmooth
07-12-2014, 08:08 AM
Stare at the center (http://youreyesarebeingviolated.ytmnd.com/)
mtb tripper
07-12-2014, 10:00 PM
The word "Hypothalamus" grows legs with tube socks and generic sneakers, eventually evolving over a time-span of 10 years to look like more like a part of the human species, closely resembling Rick Moranis. Runs down to the liquor store, finds out liquor store is closed, goes home, sleeps, wakes up, snorts a line of allergy medication, bangs his 49 year old 8th cousin, goes to sleep. Wakes up, reads a book about the scientific basis of emotions, specifically fear, goes to sleep. Wakes up Sunday morning, goes to church, shoots himself.
mtb tripper
07-12-2014, 10:00 PM
like, like, like, yeah, like yeah, like yeah yeah, like like like, like
mtb tripper
07-14-2014, 05:51 AM
Metal sr
Ahldagor
07-14-2014, 01:42 PM
Metal sr
http://www.youtube.com/watch?v=ax7qTj0aA9A
Ahldagor
07-14-2014, 01:45 PM
http://www.youtube.com/watch?v=qaIbgd71hXg
mtb tripper
07-14-2014, 10:17 PM
http://www.youtube.com/watch?v=ax7qTj0aA9A
I like this a lot
mtb tripper
07-14-2014, 10:17 PM
https://www.youtube.com/watch?v=wK0qgbUEjFQ
mtb tripper
07-15-2014, 08:30 PM
grabs eats
Ahldagor
07-15-2014, 10:22 PM
I like this a lot
random drunk night searches can be profitable
mtb tripper
07-18-2014, 11:08 PM
http://31.media.tumblr.com/a2eb6fc2bbf13216672e8af8ee4fecbc/tumblr_mw821avfbO1rpvtnuo1_500.jpg
dankzilla
07-18-2014, 11:33 PM
I like this a lot
ya this pretty sweet, glad i decided to click this thread
mtb tripper
07-19-2014, 01:45 PM
TOMATOKING
mtb tripper
07-19-2014, 07:37 PM
http://38.media.tumblr.com/52ddee21527c61db18f6acb34d10689c/tumblr_mps21qblih1syusd7o1_500.gif
http://37.media.tumblr.com/ad9e7b294f5ad8df32c76e7c9df1e481/tumblr_n7des5WoXV1syusd7o1_500.gif
http://31.media.tumblr.com/2c8a8228d4323f3491258b8ee583ca06/tumblr_mk84ak9O6y1rysvqeo1_400.gif
http://38.media.tumblr.com/3191541bb5c4862c10d9b705ad6b0bf7/tumblr_migf17rJXx1rio5c3o1_500.gif
Gaffin 7.0
07-19-2014, 07:48 PM
stay safe mtb have some fun for me
mtb tripper
07-19-2014, 11:13 PM
stay safe mtb have some fun for me
Wil do! Saturday night special!! WOOHOOORAAAAAFASDFASLDJGAWEORUASODJ BAD TRIP BAD TRIP BAD TRIP RAFLMAFRALLLGYYYY POSESSSION RALLGGGGGG
Dragonsblood1987
07-19-2014, 11:54 PM
Wil do! Saturday night special!! WOOHOOORAAAAAFASDFASLDJGAWEORUASODJ BAD TRIP BAD TRIP BAD TRIP RAFLMAFRALLLGYYYY POSESSSION RALLGGGGGG
***** you need rehab. its one thing to trip once in a while in a spiritual manner, or to smoke weed, but god damn. people who do the acid babble have completely destroyed any sort of brain they may have once had.
mtb tripper
07-20-2014, 01:18 AM
***** you need rehab. its one thing to trip once in a while in a spiritual manner, or to smoke weed, but god damn. people who do the acid babble have completely destroyed any sort of brain they may have once had.
there's no way in hell I'm going to the cuckoos nest
mtb tripper
07-20-2014, 01:19 AM
The word "Hypothalamus" grows legs with tube socks and generic sneakers, eventually evolving over a time-span of 10 years to look like more like a part of the human species, closely resembling Rick Moranis. Runs down to the liquor store, finds out liquor store is closed, goes home, sleeps, wakes up, snorts a line of allergy medication, bangs his 49 year old 8th cousin, goes to sleep. Wakes up, reads a book about the scientific basis of emotions, specifically fear, goes to sleep. Wakes up Sunday morning, goes to church, shoots himself.
pharmakos
07-20-2014, 01:42 AM
we did it
indiscriminate_hater
07-20-2014, 02:28 AM
Thread needs to die imo
Rellapse40
07-20-2014, 02:31 AM
bunch of cry baby haters
mtb tripper
07-20-2014, 02:58 AM
Thread needs to die imo
sad excuse for a flower child
phacemeltar
07-20-2014, 04:53 AM
http://www.erowid.org/culture/characters/characters_drug_use.shtml
vBulletin® v3.8.11, Copyright ©2000-2024, vBulletin Solutions Inc.